SRA1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A16296-20UL
100 ul
£336.00
A16296-100UL
500 ul
£1258.00
A16296-500UL
1000 ul
£2228.00
A16296-1000UL
About this Product
- SKU:
- A16296
- Additional Names:
- pp7684|SRA|SRA1|SRAP|STRAA1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 26kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A16296
