ACSL1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A16253-20UL
100 ul
£336.00
A16253-100UL
500 ul
£1258.00
A16253-500UL
1000 ul
£2228.00
A16253-1000UL
About this Product
- SKU:
- A16253
- Additional Names:
- ACS1|ACSL1|FACL1|FACL2|LACS|LACS1|LACS2
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene.
- Host:
- Rabbit
- Immunogen:
- This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 78 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- TRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A16253
