CEP290 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A16147-20UL
100 ul
£336.00
A16147-100UL
500 ul
£1258.00
A16147-500UL
1000 ul
£2228.00
A16147-1000UL
About this Product
- SKU:
- A16147
- Additional Names:
- 3H11Ag|BBS14|CEP290|CT87|JBTS5|LCA10|MKS4|NPHP6|POC3|rd16|SLSN6
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 290kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- QKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A16147
