SLC18A3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A16068-20UL
100 ul
£336.00
A16068-100UL
500 ul
£1258.00
A16068-500UL
1000 ul
£2228.00
A16068-1000UL
About this Product
- SKU:
- A16068
- Additional Names:
- CMS21|SLC18A3|VACHT
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50 kDa(non-glycosylated), 70 kDa(glycosylated)
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A16068
