AURKA Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A15728-20UL
100 ul
£336.00
A15728-100UL
500 ul
£1258.00
A15728-500UL
1000 ul
£2228.00
A15728-1000UL
About this Product
- SKU:
- A15728
- Additional Names:
- AIK|ARK1|AURA|AURKA|BTAK|PPP1R47|STK15|STK6|STK7
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The protein encoded by this gene is a cell cycle-regulated kinase that appears to be involved in microtubule formation and/or stabilization at the spindle pole during chromosome segregation. The encoded protein is found at the centrosome in interphase cells and at the spindle poles in mitosis. This gene may play a role in tumor development and progression. A processed pseudogene of this gene has been found on chromosome 1, and an unprocessed pseudogene has been found on chromosome 10. Multiple transcript variants encoding the same protein have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 45kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWAL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A15728
