LTBP3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A15687-20UL
100 ul
£336.00
A15687-100UL
500 ul
£1258.00
A15687-500UL
1000 ul
£2228.00
A15687-1000UL
About this Product
- SKU:
- A15687
- Additional Names:
- DASS|GPHYSD3|LTBP-3|LTBP2|LTBP3|pp6425|STHAG6
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The protein encoded by this gene forms a complex with transforming growth factor beta (TGF-beta) proteins and may be involved in their subcellular localization. Activation of this complex requires removal of the encoded binding protein. This protein also may play a structural role in the extracellular matrix. Three transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 139kDa/260kDa
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- ICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCPTSQSESNSFWDTSPLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A15687
