GNGT1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A15675-20UL
100 ul
£336.00
A15675-100UL
500 ul
£1258.00
A15675-500UL
1000 ul
£2228.00
A15675-1000UL
About this Product
- SKU:
- A15675
- Additional Names:
- GNG1|GNGT1|HG3G1
- Application:
- ELISA, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes the gamma subunit of transducin, a guanine nucleotide-binding protein (G protein) that is found in rod outer segments. Transducin, also known as GMPase, mediates the activation of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase by rhodopsin.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 10kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A15675
