EPRS Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A15245-20UL
100 ul
£336.00
A15245-100UL
500 ul
£1258.00
A15245-500UL
1000 ul
£2228.00
A15245-1000UL
About this Product
- SKU:
- A15245
- Additional Names:
- EARS|EPRS|GLUPRORS|HLD15|PARS|PIG32|QARS|QPRS
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 190kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- EAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A15245
