Acetyl-Histone H4-K5 Rabbit polyclonal antibody
Product Sizes
20 ul
£164.00
A15233-20UL
100 ul
£342.00
A15233-100UL
About this Product
- SKU:
- A15233
- Additional Names:
- Acetyl-Histone H4-K5|FO108|H4|H4-16|H4/n|H4C1|H4C11|H4C12|H4C13|H4C15|H4C16|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|H4F2|H4FN|HIST2H4|HIST2H4A
- Application:
- ChIP, ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 11kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Other Species, Rat
- Sequence:
- MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A15233










