RNF125 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A15165-20UL
100 ul
£336.00
A15165-100UL
500 ul
£1258.00
A15165-500UL
1000 ul
£2228.00
A15165-1000UL
About this Product
- SKU:
- A15165
- Additional Names:
- RNF125|TNORS|TRAC-1|TRAC1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a novel E3 ubiquitin ligase that contains a RING finger domain in the N-terminus and three zinc-binding and one ubiquitin-interacting motif in the C-terminus. As a result of myristoylation, this protein associates with membranes and is primarily localized to intracellular membrane systems. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 26kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- LEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A15165
