TRAM1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A15142-20UL
100 ul
£336.00
A15142-100UL
500 ul
£1258.00
A15142-500UL
1000 ul
£2228.00
A15142-1000UL
About this Product
- SKU:
- A15142
- Additional Names:
- PNAS8|TRAM|TRAM1|TRAMP
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a multi-pass membrane protein that is part of the mammalian endoplasmic reticulum. The encoded protein influences glycosylation and facilitates the translocation of secretory proteins across the endoplasmic reticulum membrane by regulating which domains of the nascent polypeptide chain are visible to the cytosol during a translocational pause.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 45kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- CVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A15142
