ADK Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A15023-20UL
100 ul
£336.00
A15023-100UL
500 ul
£1258.00
A15023-500UL
1000 ul
£2228.00
A15023-1000UL
About this Product
- SKU:
- A15023
- Additional Names:
- ADK|AK
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene an enzyme which catalyzes the transfer of the gamma-phosphate from ATP to adenosine, thereby serving as a regulator of concentrations of both extracellular adenosine and intracellular adenine nucleotides. Adenosine has widespread effects on the cardiovascular, nervous, respiratory, and immune systems and inhibitors of the enzyme could play an important pharmacological role in increasing intravascular adenosine concentrations and acting as anti-inflammatory agents. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 41kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- PFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A15023
