SLC25A17 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14840-20UL
100 ul
£336.00
A14840-100UL
500 ul
£1258.00
A14840-500UL
1000 ul
£2228.00
A14840-1000UL
About this Product
- SKU:
- A14840
- Additional Names:
- PMP34|SLC25A17
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a peroxisomal membrane protein that belongs to the family of mitochondrial solute carriers. It is expressed in the liver, and is likely involved in transport. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 34kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- IDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14840
