SIGMAR1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14837-20UL
100 ul
£336.00
A14837-100UL
500 ul
£1258.00
A14837-500UL
1000 ul
£2228.00
A14837-1000UL
About this Product
- SKU:
- A14837
- Additional Names:
- ALS16|DSMA2|hSigmaR1|OPRS1|SIG-1R|sigma1R|SIGMAR1|SR-BP|SR-BP1|SRBP
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 25kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- GTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14837
