KDM7A Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14692-20UL
100 ul
£336.00
A14692-100UL
500 ul
£1258.00
A14692-500UL
1000 ul
£2228.00
A14692-1000UL
About this Product
- SKU:
- A14692
- Additional Names:
- A630082K20Rik|Jhdm1d|KDM7A|mKIAA1718
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables histone H3-methyl-lysine-9 demethylase activity and histone H3-tri/di-methyl-lysine-27 demethylase activity. Involved in histone H3-K27 demethylation; histone H3-K9 demethylation; and positive regulation of transcription, DNA-templated. Predicted to be located in nucleolus and nucleoplasm. Human ortholog(s) of this gene implicated in melanoma. Orthologous to human KDM7A (lysine demethylase 7A).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 106kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- WHRHDYTEVDDGSKPVQAGTRAFVKELRSRVFPSADEIIVKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPAFSVMDVERYVGGDKVIDVIDVARQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14692
