IPO11 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14680-20UL
100 ul
£336.00
A14680-100UL
500 ul
£1258.00
A14680-500UL
1000 ul
£2228.00
A14680-1000UL
About this Product
- SKU:
- A14680
- Additional Names:
- IPO11|RanBP11
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Importins, including IPO11, are a members of the karyopherin/importin-beta family of transport receptors (see KPNB1; 602738) that mediate nucleocytoplasmic transport of protein and RNA cargoes (Plafker and Macara, 2000 [PubMed 11032817]).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 112kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- KGIIEGERYPVVMSTYLGVMGRVLLQNTSFFSSLLNEMAHKFNQEMDQLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQDKRKKMLALKDPVHTVSLQQFIYEKLKAQQEMLGEQGFQSLMETVDTEIVTQLQEFLQGF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14680
