RYBP Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14605-20UL
100 ul
£336.00
A14605-100UL
500 ul
£1258.00
A14605-500UL
1000 ul
£2228.00
A14605-1000UL
About this Product
- SKU:
- A14605
- Additional Names:
- AAP1|APAP-1|DEDAF|RYBP|YEAF1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable DNA binding activity and transcription coregulator activity. Involved in several processes, including histone H2A monoubiquitination; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; and positive regulation of transcription, DNA-templated. Located in nucleoplasm. Colocalizes with PcG protein complex.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 33kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- PSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14605
