EFNB1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14562-20UL
100 ul
£336.00
A14562-100UL
500 ul
£1258.00
A14562-500UL
1000 ul
£2228.00
A14562-1000UL
About this Product
- SKU:
- A14562
- Additional Names:
- CFND|CFNS|EFB1|EFL3|EFNB1|Elk-L|EPLG2|LERK2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- TVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14562
