CALM3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14526-20UL
100 ul
£336.00
A14526-100UL
500 ul
£1258.00
A14526-500UL
1000 ul
£2228.00
A14526-1000UL
About this Product
- SKU:
- A14526
- Additional Names:
- CALM|CALM3|CaM|CAM1|CAM2|CAMB|CaMIII|CPVT6|HEL-S-72|LQT16|PHKD|PHKD3
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a member of a family of proteins that binds calcium and functions as a enzymatic co-factor. Activity of this protein is important in the regulation of the cell cycle and cytokinesis. Multiple alternatively spliced transcript variants have been observed at this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 17kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- LGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14526
