KRBOX4 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14514-20UL
100 ul
£336.00
A14514-100UL
500 ul
£1258.00
A14514-500UL
1000 ul
£2228.00
A14514-1000UL
About this Product
- SKU:
- A14514
- Additional Names:
- KRBOX4|ZNF673
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This encodes a zinc finger protein with an N-terminal KRAB (Kruppel-associated) domain found in transcriptional repressors. This gene is located in a region of the X chromosome thought to be involved in nonsyndromic X-linked cognitive disability. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 20kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- WQAAFIGKETLKDESGQESRTCRKSIYLSTEFDSVRQRLPKYYSWEKAFKTSFKLSWSKWKLCKKER
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14514
