NGDN Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14509-20UL
100 ul
£336.00
A14509-100UL
500 ul
£1258.00
A14509-500UL
1000 ul
£2228.00
A14509-1000UL
About this Product
- SKU:
- A14509
- Additional Names:
- C14orf120|CANu1|LCP5|lpd-2|NGD|NGDN
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Neuroguidin is an EIF4E (MIM 133440)-binding protein that interacts with CPEB (MIM 607342) and functions as a translational regulatory protein during development of the vertebrate nervous system (Jung et al., 2006 [PubMed 16705177]).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to Figures
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14509
