RBX1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14500-20UL
100 ul
£336.00
A14500-100UL
500 ul
£1258.00
A14500-500UL
1000 ul
£2228.00
A14500-1000UL
About this Product
- SKU:
- A14500
- Additional Names:
- BA554C12.1|RBX1|RNF75|ROC1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 12kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14500
