WDR33 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14208-20UL
100 ul
£336.00
A14208-100UL
500 ul
£1258.00
A14208-500UL
1000 ul
£2228.00
A14208-1000UL
About this Product
- SKU:
- A14208
- Additional Names:
- 1110001N06Rik|2310011G05Rik|2810021O11Rik|8430413N20Rik|WDC146|WDR33
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to be involved in mRNA polyadenylation. Predicted to act upstream of or within mRNA processing. Located in nucleus. Orthologous to human WDR33 (WD repeat domain 33).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 145kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14208
