IFIT3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A14004-20UL
100 ul
£336.00
A14004-100UL
500 ul
£1258.00
A14004-500UL
1000 ul
£2228.00
A14004-1000UL
About this Product
- SKU:
- A14004
- Additional Names:
- Ifi49|IFIT3|P49
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable RNA binding activity and identical protein binding activity. Acts upstream of or within cellular response to interferon-beta; response to bacterium; and response to stilbenoid. Predicted to be located in mitochondrion. Predicted to be active in cytosol. Is expressed in alimentary system; eye; face; and nervous system. Orthologous to human IFIT3 (interferon induced protein with tetratricopeptide repeats 3).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 60kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- YAWIYYHMGRLSEAQAYVDKVRQVCQKFANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQFSVDALKQAM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A14004
