ACAT2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A1399-5UL
20 ul
£164.00
A1399-20UL
100 ul
£342.00
A1399-100UL
500 ul
£1532.00
A1399-500UL
1000 ul
£2704.00
A1399-1000UL
About this Product
- SKU:
- A1399
- Additional Names:
- ACAT2|acetyl-CoA acetyltransferase 2
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The product of this gene is an enzyme involved in lipid metabolism, and it encodes cytosolic acetoacetyl-CoA thiolase. This gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 41kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- GLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPAN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A1399
