Fukutin Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A1385-5UL
20 ul
£164.00
A1385-20UL
100 ul
£342.00
A1385-100UL
500 ul
£1532.00
A1385-500UL
1000 ul
£2704.00
A1385-1000UL
About this Product
- SKU:
- A1385
- Additional Names:
- CMD1X|FCMD|Fukutin|LGMD2M|LGMDR13|MDDGA4|MDDGB4|MDDGC4
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a putative transmembrane protein that is localized to the cis-Golgi compartment, where it may be involved in the glycosylation of alpha-dystroglycan in skeletal muscle. The encoded protein is thought to be a glycosyltransferase and could play a role in brain development. Defects in this gene are a cause of Fukuyama-type congenital muscular dystrophy (FCMD), Walker-Warburg syndrome (WWS), limb-girdle muscular dystrophy type 2M (LGMD2M), and dilated cardiomyopathy type 1X (CMD1X). Alternatively spliced transcript variants have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 54kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- DVKLDVFFFYEETDHMWNGGTQAKTGKKFKYLFPKFTLCWTEFVDMKVHVPCETLEYIEANYGKTWKIPVKTWDWKRSPPNVQPNGIWPISEWDEVIQLY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A1385
