ICAM-1/CD54 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A13620-20UL
100 ul
£336.00
A13620-100UL
500 ul
£1258.00
A13620-500UL
1000 ul
£2228.00
A13620-1000UL
About this Product
- SKU:
- A13620
- Additional Names:
- BB2|CD54|ICAM-1/CD54|P3.58
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 92kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- VHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A13620
