HDAC4 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A13510-5UL
20 ul
£164.00
A13510-20UL
100 ul
£342.00
A13510-100UL
500 ul
£1532.00
A13510-500UL
1000 ul
£2704.00
A13510-1000UL
About this Product
- SKU:
- A13510
- Additional Names:
- AHO3|BDMR|HA6116|HD4|HDAC-4|HDAC-A|HDAC4|HDACA|NEDCHF|NEDCHID
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 140kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A13510
