CHD2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A13478-20UL
100 ul
£336.00
A13478-100UL
500 ul
£1258.00
A13478-500UL
1000 ul
£2228.00
A13478-1000UL
About this Product
- SKU:
- A13478
- Additional Names:
- CHD2|DEE94|EEOC
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 270kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- DEFRPQNYHQQDFRRMSDHRPAMGYHGQGPSDHYRSFHTDKLGEYKQPLPPLHPAVSDPRSPPSQKSPHDSKSPLDHRSPLERSLEQKNNPDYNWNVRKT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A13478
