LLGL2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A13323-20UL
100 ul
£336.00
A13323-100UL
500 ul
£1258.00
A13323-500UL
1000 ul
£2228.00
A13323-1000UL
About this Product
- SKU:
- A13323
- Additional Names:
- 9130006H11Rik|LLGL2|Llglh2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable GTPase activator activity; PDZ domain binding activity; and myosin II binding activity. Acts upstream of or within establishment or maintenance of polarity of embryonic epithelium; labyrinthine layer development; and post-embryonic development. Predicted to be located in cytosol and intracellular membrane-bounded organelle. Predicted to be active in cortical actin cytoskeleton and plasma membrane. Is expressed in several structures, including cardiovascular system; endocrine gland; genitourinary system; gut; and nasal cavity epithelium. Orthologous to human LLGL2 (LLGL scribble cell polarity complex component 2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 114kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- DSTKAKKHNRPSNGNGTGLKMTSSGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTLEGDRRSYGNWHPHRVAVGCRLSNGEAE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A13323
