MYH6/A Alpha-MHC Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A12964-20UL
100 ul
£336.00
A12964-100UL
500 ul
£1258.00
A12964-500UL
1000 ul
£2228.00
A12964-1000UL
About this Product
- SKU:
- A12964
- Additional Names:
- alpha-MHC|ASD3|CMD1EE|CMH14|MYH6/A Alpha-MHC|MYHC|MYHCA|SSS3
- Application:
- ELISA, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located approximately 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 250 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- DPLNETVVALYQKSSLKLMATLFSSYATADTGDSGKSKGGKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A12964
