FCER1G Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A12889-20UL
100 ul
£336.00
A12889-100UL
500 ul
£1258.00
A12889-500UL
1000 ul
£2228.00
A12889-1000UL
About this Product
- SKU:
- A12889
- Additional Names:
- FCER1G|FCRG
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 12kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A12889
