RAB14 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A12752-20UL
100 ul
£336.00
A12752-100UL
500 ul
£1258.00
A12752-500UL
1000 ul
£2228.00
A12752-1000UL
About this Product
- SKU:
- A12752
- Additional Names:
- FBP|RAB-14|RAB14
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 24kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- DCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A12752
