TRPM8 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A12572-20UL
100 ul
£336.00
A12572-100UL
500 ul
£1258.00
A12572-500UL
1000 ul
£2228.00
A12572-1000UL
About this Product
- SKU:
- A12572
- Additional Names:
- LTrpC-6|LTRPC6|trp-p8|TRPM8|TRPP8
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable ligand-gated calcium channel activity. Predicted to be involved in calcium ion transmembrane transport and positive regulation of cold-induced thermogenesis. Predicted to act upstream of or within several processes, including cellular calcium ion homeostasis; response to cold; and thermoception. Located in plasma membrane.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 122kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- AFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A12572
