FCGR2B Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A12553-20UL
100 ul
£336.00
A12553-100UL
500 ul
£1258.00
A12553-500UL
1000 ul
£2228.00
A12553-1000UL
About this Product
- SKU:
- A12553
- Additional Names:
- CD32|CD32B|FCG2|FcgammaRIIb|FCGR2|FCGR2B|FCGR2C|FcGRIIB|FcRII-c|IGFR2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 40 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A12553
