ENPEP Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A12339-20UL
100 ul
£336.00
A12339-100UL
500 ul
£1258.00
A12339-500UL
1000 ul
£2228.00
A12339-1000UL
About this Product
- SKU:
- A12339
- Additional Names:
- APA|CD249|ENPEP|gp160
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The ENPEP gene encodes glutamyl aminopeptidase, a type II integral membrane protein with an extracellular zinc-binding domain. This protein can upregulate blood pressure by cleaving the N-terminal aspartate from angiotensin II, and can regulate blood vessel formation and enhance tumorigenesis in some tissues. Along with ANPEP and DPP4, ENPEP was found to be a candidate co-receptor for the coronavirus SARS-CoV-2, which causes COVID-19.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 109kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- VFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A12339
