NOX1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A12309-20UL
100 ul
£336.00
A12309-100UL
500 ul
£1258.00
A12309-500UL
1000 ul
£2228.00
A12309-1000UL
About this Product
- SKU:
- A12309
- Additional Names:
- GP91-2|MOX1|NOH-1|NOH-1L|NOH1|NOX1
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 61 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- YFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A12309
