SAA3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A11948-20UL
100 ug
£336.00
A11948-100UG
500 ul
£1258.00
A11948-500UL
1000 ul
£2228.00
A11948-1000UL
About this Product
- SKU:
- A11948
- Additional Names:
- l7R3|Saa-3|SAA3
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables Toll-like receptor 4 binding activity and chemoattractant activity. Acts upstream of or within several processes, including I-kappaB phosphorylation; cellular response to interleukin-1; and response to stilbenoid. Located in extracellular space. Is expressed in cerebellum; ileum; liver; reproductive system; and thymus. Orthologous to several human genes including SAA2 (serum amyloid A2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- SDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A11948
