HES1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A11718-20UL
100 ul
£336.00
A11718-100UL
500 ul
£1258.00
A11718-500UL
1000 ul
£2228.00
A11718-1000UL
About this Product
- SKU:
- A11718
- Additional Names:
- bHLHb39|HES-1|HES1|HHL|HRY
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 29kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- NLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A11718
