IGFBP1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A11672-5UL
20 ul
£164.00
A11672-20UL
100 ul
£342.00
A11672-100UL
500 ul
£1532.00
A11672-500UL
1000 ul
£2704.00
A11672-1000UL
About this Product
- SKU:
- A11672
- Additional Names:
- AFBP|hIGFBP-1|IBP1|IGF-BP25|IGFBP1|PP12
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 30kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A11672
