[KD Validated] Proprotein Convertase 9(PCSK9) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A11532-5UL
20 ul
£164.00
A11532-20UL
100 ul
£342.00
A11532-100UL
500 ul
£1532.00
A11532-500UL
1000 ul
£2704.00
A11532-1000UL
About this Product
- SKU:
- A11532
- Additional Names:
- [KD Validated] Proprotein Convertase 9(PCSK9)|FH3|FHCL3|HCHOLA3|LDLCQ1|NARC-1|NARC1|PC9
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Mutations in this gene have been associated with autosomal dominant familial hypercholesterolemia. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 65kDa/80kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- EASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A11532
