CD41/ITGA2B Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A11490-5UL
20 ul
£164.00
A11490-20UL
100 ul
£342.00
A11490-100UL
500 ul
£1532.00
A11490-500UL
1000 ul
£2704.00
A11490-1000UL
About this Product
- SKU:
- A11490
- Additional Names:
- BDPLT16|BDPLT2|CD41|CD41/ITGA2B|CD41B|GP2B|GPIIb|GT|GT1|GTA|HPA3|PPP1R93
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the integrin alpha chain family of proteins. The encoded preproprotein is proteolytically processed to generate light and heavy chains that associate through disulfide linkages to form a subunit of the alpha-IIb/beta-3 integrin cell adhesion receptor. This receptor plays a crucial role in the blood coagulation system, by mediating platelet aggregation. Mutations in this gene are associated with platelet-type bleeding disorders, which are characterized by a failure of platelet aggregation, including Glanzmann thrombasthenia.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 113-135 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A11490
