TRADD Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A1145-20UL
100 ul
£336.00
A1145-100UL
500 ul
£1258.00
A1145-500UL
1000 ul
£2228.00
A1145-1000UL
About this Product
- SKU:
- A1145
- Additional Names:
- 9130005N23Rik|TRADD
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable death domain binding activity; identical protein binding activity; and signaling receptor binding activity. Involved in positive regulation of hair follicle development. Acts upstream of or within extrinsic apoptotic signaling pathway. Located in cytoplasm. Is expressed in adrenal gland; genitourinary system; liver; lung; and spleen. Orthologous to human TRADD (TNFRSF1A associated via death domain).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 36kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- AQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A1145
