Ki67 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A11390-20UL
100 ul
£336.00
A11390-100UL
500 ul
£1258.00
A11390-500UL
1000 ul
£2228.00
A11390-1000UL
About this Product
- SKU:
- A11390
- Additional Names:
- Ki67|KIA|MIB-|MIB-1|PPP1R105
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence
- Clonality:
- Polyclonal
- Extra Details:
- Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 359kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- GEVHSQFSTGHANSPCTIIIGKAHTEKVHVPARPYRVLNNFISNQKMDFKEDLSGIAEMFKTPVKEQPQLTSTCHIAISNSENLLGKQFQGTDSGEEPLLP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A11390
