c-Jun Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A11378-20UL
100 ul
£336.00
A11378-100UL
500 ul
£1258.00
A11378-500UL
1000 ul
£2228.00
A11378-1000UL
About this Product
- SKU:
- A11378
- Additional Names:
- AP-1|AP1|c-Jun|cJUN|p39
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 43kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A11378
