DDX5 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A11339-5UL
20 ul
£164.00
A11339-20UL
100 ul
£342.00
A11339-100UL
500 ul
£1532.00
A11339-500UL
1000 ul
£2704.00
A11339-1000UL
About this Product
- SKU:
- A11339
- Additional Names:
- DDX5|G17P1|HLR1|HUMP68|p68
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 69kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEAN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A11339
