CXCR3 Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A11294-20UL
100 ul
£342.00
A11294-100UL
About this Product
- SKU:
- A11294
- Additional Names:
- CD182|CD183|CKR-L2|CMKAR3|CXCR3|GPR9|IP10-R|Mig-R|MigR
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 41kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- ATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A11294
