Gsdma Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A10602-20UL
100 ul
£336.00
A10602-100UL
500 ul
£1258.00
A10602-500UL
1000 ul
£2228.00
A10602-1000UL
About this Product
- SKU:
- A10602
- Additional Names:
- Gsdm|Gsdm1|Gsdma|Gsdma1|H312E
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylserine binding activity. Predicted to be involved in apoptotic process; defense response to bacterium; and pyroptosis. Predicted to act upstream of or within programmed cell death. Located in cytoplasm. Is expressed in esophagus epithelium; stomach; stomach cardiac region; stomach glandular region; and stomach glandular region mucosa. Orthologous to human GSDMA (gasdermin A).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 49kDa
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- ASDVGEMHEDFKTLKEEVQRETQEVEKLSPVGRSSLLTSLSHLLGKKKELQDLEQTLEGALDKGHEVTLEALPKDVLLSKDAMDAILYFLGALTVLSEAQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A10602
