PARG Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A10577-20UL
100 ul
£336.00
A10577-100UL
500 ul
£1258.00
A10577-500UL
1000 ul
£2228.00
A10577-1000UL
About this Product
- SKU:
- A10577
- Additional Names:
- PARG|PARG99
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Poly(ADP-ribose) glycohydrolase (PARG) is the major enzyme responsible for the catabolism of poly(ADP-ribose), a reversible covalent-modifier of chromosomal proteins. The protein is found in many tissues and may be subject to proteolysis generating smaller, active products. Several transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 120-130 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- HNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A10577
