SCN2A Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A10574-20UL
100 ul
£336.00
A10574-100UL
500 ul
£1258.00
A10574-500UL
1000 ul
£2228.00
A10574-1000UL
About this Product
- SKU:
- A10574
- Additional Names:
- BFIC3|BFIS3|BFNIS|DEE11|EA9|EIEE11|HBA|HBSCI|HBSCII|Na(v)1.2|NAC2|Nav1.2|SCN2A|SCN2A1|SCN2A2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with four repeat domains, each of which is composed of six membrane-spanning segments, and one or more regulatory beta subunits. Voltage-gated sodium channels function in the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family. Allelic variants of this gene are associated with seizure disorders and autism spectrum disorder. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 250kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- RNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A10574
